PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001376m
Common NameCARUB_v10001376mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 338aa    MW: 38157.5 Da    PI: 9.5878
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001376mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-1698143147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+q+G+ +W++Ia+++  gR++k+c++rw++ 
  Carubv10001376m  98 RGHWRPTEDAKLKELVAQFGPQNWNLIAHHLL-GRSGKSCRLRWFNQ 143
                      899****************************9.***********996 PP

2Myb_DNA-binding51.72e-16151193246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++T+eE+ +l+ a++ +G++ W+ I+r ++ gRt++ +k++w+ 
  Carubv10001376m 151 RAFTEEEEFRLLAAHQSYGNK-WAMISRLFP-GRTDNAVKNHWHV 193
                      689******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.50793144IPR017930Myb domain
SMARTSM007173.4E-1497146IPR001005SANT/Myb domain
PfamPF002497.1E-1698143IPR001005SANT/Myb domain
SuperFamilySSF466894.12E-2898191IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-2599151IPR009057Homeodomain-like
CDDcd001675.42E-13101142No hitNo description
PROSITE profilePS5129424.329145199IPR017930Myb domain
SMARTSM007171.7E-13149197IPR001005SANT/Myb domain
PfamPF002494.0E-13151192IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-19152197IPR009057Homeodomain-like
CDDcd001671.68E-10152192No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051782Biological Processnegative regulation of cell division
GO:0071367Biological Processcellular response to brassinosteroid stimulus
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MNPYLLEKDL VAGNETINGS RSRFENANNF GSLPNSHTAA SRKTSLTNLS LSRNHPLNNK  60
PASVLEPEDE HGEKDKGEND KRMRMRGKNG INTKVCSRGH WRPTEDAKLK ELVAQFGPQN  120
WNLIAHHLLG RSGKSCRLRW FNQLDPRINK RAFTEEEEFR LLAAHQSYGN KWAMISRLFP  180
GRTDNAVKNH WHVIMARRSR ESQRQRQQPP LAAPSRDAEM TVSSSCRREF FGNVAKGSFV  240
NEEDDEDDDD GSAVSTCTTE LSLTPPSSAH QPRFLNYDNT LASGKDGQCV QRAEVNGIYG  300
KKMDHQNHHT ITVSERKVEK KMKSGFYFFD FLGVGAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31981987107B-MYB
1h89_C5e-319819858158MYB PROTO-ONCOGENE PROTEIN
1h88_C5e-319819858158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17985DKRMRMR
28085KRMRMR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00516DAPTransfer from AT5G17800Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667390.0KC966739.1 Brassica napus MYB transcription factor 56 (MYB56.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006286529.10.0hypothetical protein CARUB_v10001376mg
TrEMBLR0FBJ80.0R0FBJ8_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.6__1780__AT5G17800.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99771836
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17800.10.0myb domain protein 56